PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.001G219000.1
Common NamePHAVU_001G219000g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB
Protein Properties Length: 405aa    MW: 45040.4 Da    PI: 7.1869
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.001G219000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.62.6e-171461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g W++eEde+l++ ++++G g+W+++++  g+ R++k+c++rw +yl
  Phvul.001G219000.1 14 KGLWSPEEDEKLLRHITKYGHGCWSSVPKQAGLQRCGKSCRLRWINYL 61
                        678*******************************************97 PP

2Myb_DNA-binding44.63.2e-1467110146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         rg ++ eE+ l++++++ lG++ W+ Ia+ ++ gRt++++k+ w++
  Phvul.001G219000.1  67 RGTFSLEEENLIIELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                         899*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.0E-28664IPR009057Homeodomain-like
PROSITE profilePS5129418.926961IPR017930Myb domain
SuperFamilySSF466892.09E-2912108IPR009057Homeodomain-like
SMARTSM007172.7E-131363IPR001005SANT/Myb domain
PfamPF002492.9E-151461IPR001005SANT/Myb domain
CDDcd001678.51E-121761No hitNo description
PROSITE profilePS5129425.1462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.7E-2565116IPR009057Homeodomain-like
SMARTSM007178.4E-1366114IPR001005SANT/Myb domain
PfamPF002493.8E-1367111IPR001005SANT/Myb domain
CDDcd001674.89E-969109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 405 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLRHIT KYGHGCWSSV PKQAGLQRCG KSCRLRWINY  60
LRPDLKRGTF SLEEENLIIE LHAVLGNRWS QIAAQLPGRT DNEIKNLWNS CLKKKLRQRG  120
INPVTHKPLS EVENGEEDKT RSQELSNELN LLNSESFKSD EGSYEQRASS IAPKAYEMEG  180
SCSSKINTKN DTNLIANCSN KDLFLDSYTT SCQPSDLMGN YPLQMTDNLP TNSNSSHWFS  240
PTARTSDINS EFTSNVMSIL PPTTTSFLPG TSFCYKPSLA VPSEDISTPP FALNGPNYWE  300
SSASNNSNGS NTSDGSRELT SSKNSVLSSW GLTEEAKWSE YLHNPMLMLA APESLCNQIR  360
PATHLVPDNT LGSIMPGSKE QLQSQTSPIF SKDIQKLTAA FGHI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28121165108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKKLRQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150370.0AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007163255.10.0hypothetical protein PHAVU_001G219000g
TrEMBLV7CYS20.0V7CYS2_PHAVU; Uncharacterized protein
STRINGGLYMA19G41010.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01680.35e-94myb domain protein 55